Brand: | Abnova |
Reference: | H00003707-M01 |
Product name: | ITPKB monoclonal antibody (M01), clone 2F8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ITPKB. |
Clone: | 2F8 |
Isotype: | IgG2b Kappa |
Gene id: | 3707 |
Gene name: | ITPKB |
Gene alias: | IP3K|IP3K-B|IP3KB|PIG37 |
Gene description: | inositol 1,4,5-trisphosphate 3-kinase B |
Genbank accession: | NM_002221 |
Immunogen: | ITPKB (NP_002212, 545 a.a. ~ 643 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PELLPQDQDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPERTLDPNSAFLHTLDQQKPR |
Protein accession: | NP_002212 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ITPKB monoclonal antibody (M01), clone 2F8 Western Blot analysis of ITPKB expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Human inositol-1,4,5-trisphosphate 3-kinase isoform B (IP3KB) is a nucleocytoplasmic shuttling protein specifically enriched at cortical actin filaments and at invaginations of the nuclear envelope.Nalaskowski MM, Fliegert R, Ernst O, Brehm MA, Fanick W, Windhorst S, Lin H, Giehler S, Hein J, Lin YN, Mayr GW. J Biol Chem. 2010 Dec 9. [Epub ahead of print] |