Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITM1 monoclonal antibody (M02), clone 4D4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about ITM1 monoclonal antibody (M02), clone 4D4
| Brand: | Abnova |
| Reference: | H00003703-M02 |
| Product name: | ITM1 monoclonal antibody (M02), clone 4D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ITM1. |
| Clone: | 4D4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3703 |
| Gene name: | STT3A |
| Gene alias: | FLJ27038|ITM1|MGC9042|STT3-A|TMC |
| Gene description: | STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) |
| Genbank accession: | NM_152713 |
| Immunogen: | ITM1 (NP_689926, 603 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG |
| Protein accession: | NP_689926 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to ITM1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Keratinocyte-associated protein 2 is a bona fide subunit of the mammalian oligosaccharyltransferase.Roboti P, High S. J Cell Sci. 2012 Jan 1;125(Pt 1):220-32. Epub 2012 Jan 20. |