Brand: | Abnova |
Reference: | H00003695-M01 |
Product name: | ITGB7 monoclonal antibody (M01), clone 8D3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ITGB7. |
Clone: | 8D3 |
Isotype: | IgG2a Kappa |
Gene id: | 3695 |
Gene name: | ITGB7 |
Gene alias: | - |
Gene description: | integrin, beta 7 |
Genbank accession: | NM_000889 |
Immunogen: | ITGB7 (NP_000880, 401 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSDTQPQAPHCSDGQGHLQCGVCSCAPG |
Protein accession: | NP_000880 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged ITGB7 is approximately 3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |