ITGB6 monoclonal antibody (M03), clone 4C3 View larger

ITGB6 monoclonal antibody (M03), clone 4C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ITGB6 monoclonal antibody (M03), clone 4C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ITGB6 monoclonal antibody (M03), clone 4C3

Brand: Abnova
Reference: H00003694-M03
Product name: ITGB6 monoclonal antibody (M03), clone 4C3
Product description: Mouse monoclonal antibody raised against a partial recombinant ITGB6.
Clone: 4C3
Isotype: IgG2a Kappa
Gene id: 3694
Gene name: ITGB6
Gene alias: -
Gene description: integrin, beta 6
Genbank accession: NM_000888
Immunogen: ITGB6 (NM_000888, 604 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPN
Protein accession: NM_000888
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003694-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.18 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003694-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ITGB6 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ITGB6 monoclonal antibody (M03), clone 4C3 now

Add to cart