Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ITGB4BP polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about ITGB4BP polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00003692-A01 |
| Product name: | ITGB4BP polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ITGB4BP. |
| Gene id: | 3692 |
| Gene name: | EIF6 |
| Gene alias: | 2|CAB|EIF3A|ITGB4BP|b|b(2)gcn|gcn|p27BBP |
| Gene description: | eukaryotic translation initiation factor 6 |
| Genbank accession: | NM_002212 |
| Immunogen: | ITGB4BP (NP_002203, 146 a.a. ~ 245 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT |
| Protein accession: | NP_002203 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | ITGB4BP polyclonal antibody (A01), Lot # 051122JC01 Western Blot analysis of ITGB4BP expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of ITGB4BP as a new interaction protein of P311.Peng X, Yuan S, Tan J, Ma B, Bian X, Xu C, He W, Cao H, Huang Z, Cui Y, Gan C, Wang X, Zhou J, Hu J, Yang S, Luo G, Wu J. Life Sci. 2012 Feb 16. [Epub ahead of print] |