Brand: | Abnova |
Reference: | H00003673-A01 |
Product name: | ITGA2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ITGA2. |
Gene id: | 3673 |
Gene name: | ITGA2 |
Gene alias: | BR|CD49B|GPIa|VLA-2|VLAA2 |
Gene description: | integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) |
Genbank accession: | NM_002203 |
Immunogen: | ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL |
Protein accession: | NP_002194.2 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |