ITGA2 polyclonal antibody (A01) View larger

ITGA2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ITGA2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ITGA2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003673-A01
Product name: ITGA2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ITGA2.
Gene id: 3673
Gene name: ITGA2
Gene alias: BR|CD49B|GPIa|VLA-2|VLAA2
Gene description: integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor)
Genbank accession: NM_002203
Immunogen: ITGA2 (NP_002194.2, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL
Protein accession: NP_002194.2
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003673-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ITGA2 polyclonal antibody (A01) now

Add to cart