IRF4 monoclonal antibody (M10), clone 3C4 View larger

IRF4 monoclonal antibody (M10), clone 3C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRF4 monoclonal antibody (M10), clone 3C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about IRF4 monoclonal antibody (M10), clone 3C4

Brand: Abnova
Reference: H00003662-M10
Product name: IRF4 monoclonal antibody (M10), clone 3C4
Product description: Mouse monoclonal antibody raised against a partial recombinant IRF4.
Clone: 3C4
Isotype: IgG2a Kappa
Gene id: 3662
Gene name: IRF4
Gene alias: LSIRF|MUM1
Gene description: interferon regulatory factor 4
Genbank accession: NM_002460
Immunogen: IRF4 (NP_002451, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LCNDRPNKLERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNSGHFLRGYDLPEHISNPEDYHRSIRHSSIQE
Protein accession: NP_002451
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003662-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003662-M10-13-15-1.jpg
Application image note: Western Blot analysis of IRF4 expression in transfected 293T cell line by IRF4 monoclonal antibody (M10), clone 3C4.

Lane 1: IRF4 transfected lysate(51.8 KDa).
Lane 2: Non-transfected lysate.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IRF4 monoclonal antibody (M10), clone 3C4 now

Add to cart