IRF2 monoclonal antibody (M04), clone 7C2 View larger

IRF2 monoclonal antibody (M04), clone 7C2

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRF2 monoclonal antibody (M04), clone 7C2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about IRF2 monoclonal antibody (M04), clone 7C2

Brand: Abnova
Reference: H00003660-M04
Product name: IRF2 monoclonal antibody (M04), clone 7C2
Product description: Mouse monoclonal antibody raised against a partial recombinant IRF2.
Clone: 7C2
Isotype: IgG2a Kappa
Gene id: 3660
Gene name: IRF2
Gene alias: DKFZp686F0244|IRF-2
Gene description: interferon regulatory factor 2
Genbank accession: NM_002199
Immunogen: IRF2 (NP_002190, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
Protein accession: NP_002190
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003660-M04-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003660-M04-1-25-1.jpg
Application image note: IRF2 monoclonal antibody (M04), clone 7C2 Western Blot analysis of IRF2 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IRF2 monoclonal antibody (M04), clone 7C2 now

Add to cart