IRAK2 monoclonal antibody (M01), clone 6C7 View larger

IRAK2 monoclonal antibody (M01), clone 6C7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IRAK2 monoclonal antibody (M01), clone 6C7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about IRAK2 monoclonal antibody (M01), clone 6C7

Brand: Abnova
Reference: H00003656-M01
Product name: IRAK2 monoclonal antibody (M01), clone 6C7
Product description: Mouse monoclonal antibody raised against a partial recombinant IRAK2.
Clone: 6C7
Isotype: IgG1 Kappa
Gene id: 3656
Gene name: IRAK2
Gene alias: IRAK-2|MGC150550
Gene description: interleukin-1 receptor-associated kinase 2
Genbank accession: NM_001570
Immunogen: IRAK2 (NP_001561, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
Protein accession: NP_001561
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003656-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003656-M01-3-25-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to IRAK2 on formalin-fixed paraffin-embedded human transitional cell carcinoma. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IRAK2 monoclonal antibody (M01), clone 6C7 now

Add to cart