INPPL1 monoclonal antibody (M01), clone 3E6 View larger

INPPL1 monoclonal antibody (M01), clone 3E6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of INPPL1 monoclonal antibody (M01), clone 3E6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about INPPL1 monoclonal antibody (M01), clone 3E6

Brand: Abnova
Reference: H00003636-M01
Product name: INPPL1 monoclonal antibody (M01), clone 3E6
Product description: Mouse monoclonal antibody raised against a partial recombinant INPPL1.
Clone: 3E6
Isotype: IgG1 Kappa
Gene id: 3636
Gene name: INPPL1
Gene alias: SHIP2
Gene description: inositol polyphosphate phosphatase-like 1
Genbank accession: NM_001567
Immunogen: INPPL1 (NP_001558, 1159 a.a. ~ 1258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Protein accession: NP_001558
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003636-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003636-M01-1-1-1.jpg
Application image note: INPPL1 monoclonal antibody (M01), clone 3E6 Western Blot analysis of INPPL1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy INPPL1 monoclonal antibody (M01), clone 3E6 now

Add to cart