Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of INPP5A monoclonal antibody (M05), clone 3D8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,IP |
More info about INPP5A monoclonal antibody (M05), clone 3D8
| Brand: | Abnova |
| Reference: | H00003632-M05 |
| Product name: | INPP5A monoclonal antibody (M05), clone 3D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant INPP5A. |
| Clone: | 3D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 3632 |
| Gene name: | INPP5A |
| Gene alias: | 5PTASE|DKFZp434A1721|MGC116947|MGC116949 |
| Gene description: | inositol polyphosphate-5-phosphatase, 40kDa |
| Genbank accession: | NM_005539 |
| Immunogen: | INPP5A (NP_005530, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW |
| Protein accession: | NP_005530 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |