Brand: | Abnova |
Reference: | H00003632-M05 |
Product name: | INPP5A monoclonal antibody (M05), clone 3D8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant INPP5A. |
Clone: | 3D8 |
Isotype: | IgG2a Kappa |
Gene id: | 3632 |
Gene name: | INPP5A |
Gene alias: | 5PTASE|DKFZp434A1721|MGC116947|MGC116949 |
Gene description: | inositol polyphosphate-5-phosphatase, 40kDa |
Genbank accession: | NM_005539 |
Immunogen: | INPP5A (NP_005530, 288 a.a. ~ 387 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YFNQEVFRDNNGTALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKELVLRVSVCCPSPGHRGMWSAGSGLAQPW |
Protein accession: | NP_005530 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged INPP5A is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |