INPP1 monoclonal antibody (M11A), clone 4F9 View larger

INPP1 monoclonal antibody (M11A), clone 4F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of INPP1 monoclonal antibody (M11A), clone 4F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about INPP1 monoclonal antibody (M11A), clone 4F9

Brand: Abnova
Reference: H00003628-M11A
Product name: INPP1 monoclonal antibody (M11A), clone 4F9
Product description: Mouse monoclonal antibody raised against a partial recombinant INPP1.
Clone: 4F9
Isotype: IgG2a Kappa
Gene id: 3628
Gene name: INPP1
Gene alias: MGC110984
Gene description: inositol polyphosphate-1-phosphatase
Genbank accession: NM_002194
Immunogen: INPP1 (NP_002185, 300 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLVDIYIFSEDTTFKWDSCAAHAILRAMGGGIVDLKECLERNPETGLDLPQLVYHVENEGAAGVDRWANKGGLIAYRSRKRLETFLSLLVQNLAPAETHT
Protein accession: NP_002185
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003628-M11A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003628-M11A-13-15-1.jpg
Application image note: Western Blot analysis of INPP1 expression in transfected 293T cell line by INPP1 monoclonal antibody (M11A), clone 4F9.

Lane 1: INPP1 transfected lysate(44 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy INPP1 monoclonal antibody (M11A), clone 4F9 now

Add to cart