ING1 monoclonal antibody (M08), clone 3E7 View larger

ING1 monoclonal antibody (M08), clone 3E7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ING1 monoclonal antibody (M08), clone 3E7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ING1 monoclonal antibody (M08), clone 3E7

Brand: Abnova
Reference: H00003621-M08
Product name: ING1 monoclonal antibody (M08), clone 3E7
Product description: Mouse monoclonal antibody raised against a partial recombinant ING1.
Clone: 3E7
Isotype: IgG1 kappa
Gene id: 3621
Gene name: ING1
Gene alias: p24ING1c|p33|p33ING1|p33ING1b|p47|p47ING1a
Gene description: inhibitor of growth family, member 1
Genbank accession: NM_198219.1
Immunogen: ING1 (NP_937862.1, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAA
Protein accession: NP_937862.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003621-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003621-M08-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ING1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ING1 monoclonal antibody (M08), clone 3E7 now

Add to cart