Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00003620-M16 |
Product name: | IDO1 monoclonal antibody (M16), clone 1C1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IDO1. |
Clone: | 1C1 |
Isotype: | IgG2a Kappa |
Gene id: | 3620 |
Gene name: | IDO1 |
Gene alias: | CD107B|IDO|INDO |
Gene description: | indoleamine 2,3-dioxygenase 1 |
Genbank accession: | NM_002164 |
Immunogen: | IDO1 (NP_002155, 304 a.a. ~ 403 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG |
Protein accession: | NP_002155 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IDO1 expression in transfected 293T cell line by IDO1 monoclonal antibody (M16), clone 1C1. Lane 1: IDO1 transfected lysate(45.3 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |