IDO1 monoclonal antibody (M14), clone 1D5 View larger

IDO1 monoclonal antibody (M14), clone 1D5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IDO1 monoclonal antibody (M14), clone 1D5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,ELISA,WB-Re

More info about IDO1 monoclonal antibody (M14), clone 1D5

Brand: Abnova
Reference: H00003620-M14
Product name: IDO1 monoclonal antibody (M14), clone 1D5
Product description: Mouse monoclonal antibody raised against a full-length recombinant IDO1.
Clone: 1D5
Isotype: IgG2a Kappa
Gene id: 3620
Gene name: IDO1
Gene alias: CD107B|IDO|INDO
Gene description: indoleamine 2,3-dioxygenase 1
Genbank accession: NM_002164
Immunogen: IDO1 (NP_002155, 304 a.a. ~ 403 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
Protein accession: NP_002155
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003620-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003620-M14-2-A1-1.jpg
Application image note: IDO1 monoclonal antibody (M14), clone 1D5. Western Blot analysis of IDO1 expression in human liver.
Applications: WB-Ti,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IDO1 monoclonal antibody (M14), clone 1D5 now

Add to cart