IMPDH1 purified MaxPab mouse polyclonal antibody (B01P) View larger

IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

H00003614-B01P_50ug

New product

395,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003614-B01P
Product name: IMPDH1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IMPDH1 protein.
Gene id: 3614
Gene name: IMPDH1
Gene alias: DKFZp781N0678|IMPD|IMPD1|LCA11|RP10|sWSS2608
Gene description: IMP (inosine monophosphate) dehydrogenase 1
Genbank accession: NM_183243.1
Immunogen: IMPDH1 (NP_899066.1, 1 a.a. ~ 563 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTREDDKYRLDLLTQAGVDVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Protein accession: NP_899066.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003614-B01P-2-A4-1.jpg
Application image note: IMPDH1 MaxPab polyclonal antibody. Western Blot analysis of IMPDH1 expression in human spleen.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IMPDH1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart