IMPA1 monoclonal antibody (M01), clone 1E6-F11 View larger

IMPA1 monoclonal antibody (M01), clone 1E6-F11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IMPA1 monoclonal antibody (M01), clone 1E6-F11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IMPA1 monoclonal antibody (M01), clone 1E6-F11

Brand: Abnova
Reference: H00003612-M01
Product name: IMPA1 monoclonal antibody (M01), clone 1E6-F11
Product description: Mouse monoclonal antibody raised against a full length recombinant IMPA1.
Clone: 1E6-F11
Isotype: IgG1 Kappa
Gene id: 3612
Gene name: IMPA1
Gene alias: IMPA
Gene description: inositol(myo)-1(or 4)-monophosphatase 1
Genbank accession: BC008381
Immunogen: IMPA1 (AAH08381, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Protein accession: AAH08381
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003612-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003612-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged IMPA1 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IMPA1 monoclonal antibody (M01), clone 1E6-F11 now

Add to cart