IMPA1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,IF,WB-Tr

More info about IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003612-D01P
Product name: IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IMPA1 protein.
Gene id: 3612
Gene name: IMPA1
Gene alias: IMPA
Gene description: inositol(myo)-1(or 4)-monophosphatase 1
Genbank accession: NM_005536.2
Immunogen: IMPA1 (NP_005527.1, 1 a.a. ~ 277 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Protein accession: NP_005527.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00003612-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IMPA1 expression in transfected 293T cell line (H00003612-T01) by IMPA1 MaxPab polyclonal antibody.

Lane 1: IMPA1 transfected lysate(30.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IMPA1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart