IMPA1 polyclonal antibody (A01) View larger

IMPA1 polyclonal antibody (A01)

H00003612-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IMPA1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IMPA1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003612-A01
Product name: IMPA1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a full-length recombinant IMPA1.
Gene id: 3612
Gene name: IMPA1
Gene alias: IMPA
Gene description: inositol(myo)-1(or 4)-monophosphatase 1
Genbank accession: BC008381
Immunogen: IMPA1 (AAH08381, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence: MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Protein accession: AAH08381
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003612-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (56.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice
Publications: A long hangover from party drugs: Residual proteomic changes in the hippocampus of rats 8 weeks after γ-hydroxybutyrate (GHB); 3,4-Methylenedioxymethamphetamine (MDMA) or their combination.van Nieuwenhuijzen PS, Kashem MA, Matsumoto I, Hunt GE, McGregor IS.
Neurochem Int. 2010 Mar 11. [Epub ahead of print]

Reviews

Buy IMPA1 polyclonal antibody (A01) now

Add to cart