ILF2 polyclonal antibody (A01) View larger

ILF2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ILF2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about ILF2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003608-A01
Product name: ILF2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ILF2.
Gene id: 3608
Gene name: ILF2
Gene alias: MGC8391|NF45|PRO3063
Gene description: interleukin enhancer binding factor 2, 45kDa
Genbank accession: NM_004515
Immunogen: ILF2 (NP_004506, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH
Protein accession: NP_004506
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003608-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003608-A01-1-34-1.jpg
Application image note: ILF2 polyclonal antibody (A01), Lot # 050928JC01 Western Blot analysis of ILF2 expression in SJCRH30 ( Cat # L027V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ILF2 polyclonal antibody (A01) now

Add to cart