IL15RA monoclonal antibody (M01), clone 1C5 View larger

IL15RA monoclonal antibody (M01), clone 1C5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL15RA monoclonal antibody (M01), clone 1C5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL15RA monoclonal antibody (M01), clone 1C5

Brand: Abnova
Reference: H00003601-M01
Product name: IL15RA monoclonal antibody (M01), clone 1C5
Product description: Mouse monoclonal antibody raised against a partial recombinant IL15RA.
Clone: 1C5
Isotype: IgG2b Kappa
Gene id: 3601
Gene name: IL15RA
Gene alias: MGC104179
Gene description: interleukin 15 receptor, alpha
Genbank accession: NM_002189
Immunogen: IL15RA (NP_002180, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
Protein accession: NP_002180
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003601-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003601-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged IL15RA is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL15RA monoclonal antibody (M01), clone 1C5 now

Add to cart