Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL15 monoclonal antibody (M18A), clone 2F9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about IL15 monoclonal antibody (M18A), clone 2F9
| Brand: | Abnova |
| Reference: | H00003600-M18A |
| Product name: | IL15 monoclonal antibody (M18A), clone 2F9 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL15. |
| Clone: | 2F9 |
| Isotype: | IgG1 Kappa |
| Gene id: | 3600 |
| Gene name: | IL15 |
| Gene alias: | IL-15|MGC9721 |
| Gene description: | interleukin 15 |
| Genbank accession: | N/A |
| Immunogen: | IL15 (NM_000585.2, 46 a.a. ~ 162 a.a) full-length recombinant protein. |
| Immunogen sequence/protein sequence: | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS |
| Protein accession: | - |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (12.54 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of IL15 expression in transfected 293T cell line by IL15 monoclonal antibody (M18A), clone 2F9. Lane 1: IL15 transfected lysate(18.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |