IL15 monoclonal antibody (M04), clone 1H8 View larger

IL15 monoclonal antibody (M04), clone 1H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL15 monoclonal antibody (M04), clone 1H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA

More info about IL15 monoclonal antibody (M04), clone 1H8

Brand: Abnova
Reference: H00003600-M04
Product name: IL15 monoclonal antibody (M04), clone 1H8
Product description: Mouse monoclonal antibody raised against a full length recombinant IL15.
Clone: 1H8
Isotype: IgG2a Kappa
Gene id: 3600
Gene name: IL15
Gene alias: IL-15|MGC9721
Gene description: interleukin 15
Genbank accession: NM_000585
Immunogen: IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.
Immunogen sequence/protein sequence: NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Protein accession: NP_000576
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003600-M04-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to IL15 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA
Shipping condition: Dry Ice

Reviews

Buy IL15 monoclonal antibody (M04), clone 1H8 now

Add to cart