Brand: | Abnova |
Reference: | H00003572-M05 |
Product name: | IL6ST monoclonal antibody (M05), clone 2A4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL6ST. |
Clone: | 2A4 |
Isotype: | IgG2b Kappa |
Gene id: | 3572 |
Gene name: | IL6ST |
Gene alias: | CD130|CDw130|GP130|GP130-RAPS|IL6R-beta |
Gene description: | interleukin 6 signal transducer (gp130, oncostatin M receptor) |
Genbank accession: | NM_002184 |
Immunogen: | IL6ST (NP_002175, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ELLDPCGYISPESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFTDIASLNIQLTCNILTFGQLEQNVYGITIIS |
Protein accession: | NP_002175 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IL6ST is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |