Brand: | Abnova |
Reference: | H00003570-M02 |
Product name: | IL6R monoclonal antibody (M02), clone 1E11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL6R. |
Clone: | 1E11 |
Isotype: | IgG1 Kappa |
Gene id: | 3570 |
Gene name: | IL6R |
Gene alias: | CD126|IL-6R-1|IL-6R-alpha|IL6RA|MGC104991 |
Gene description: | interleukin 6 receptor |
Genbank accession: | NM_000565 |
Immunogen: | IL6R (NP_000556, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | APRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS |
Protein accession: | NP_000556 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003570-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003570-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003570-M02-9-20-1.jpg](http://www.abnova.com/application_image/H00003570-M02-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged IL6R is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |