Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Tr |
Brand: | Abnova |
Reference: | H00003569-M10 |
Product name: | IL6 monoclonal antibody (M10), clone 4B12 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IL6. |
Clone: | 4B12 |
Isotype: | IgG2b Kappa |
Gene id: | 3569 |
Gene name: | IL6 |
Gene alias: | BSF2|HGF|HSF|IFNB2|IL-6 |
Gene description: | interleukin 6 (interferon, beta 2) |
Genbank accession: | NM_000600 |
Immunogen: | IL6 (NP_000591, 29 a.a.-212 a.a.) full-length recombinant protein. |
Immunogen sequence/protein sequence: | SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
Protein accession: | NP_000591 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 monoclonal antibody (M10), clone 4B12. Lane 1: IL6 transfected lysate(23.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Tr |
Shipping condition: | Dry Ice |