IL6 monoclonal antibody (M09), clone 3F12 View larger

IL6 monoclonal antibody (M09), clone 3F12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL6 monoclonal antibody (M09), clone 3F12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Tr

More info about IL6 monoclonal antibody (M09), clone 3F12

Brand: Abnova
Reference: H00003569-M09
Product name: IL6 monoclonal antibody (M09), clone 3F12
Product description: Mouse monoclonal antibody raised against a full-length recombinant IL6.
Clone: 3F12
Isotype: IgG2b Kappa
Gene id: 3569
Gene name: IL6
Gene alias: BSF2|HGF|HSF|IFNB2|IL-6
Gene description: interleukin 6 (interferon, beta 2)
Genbank accession: NM_000600
Immunogen: IL6 (NP_000591, 29 a.a.-212 a.a.) full-length recombinant protein.
Immunogen sequence/protein sequence: SPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Protein accession: NP_000591
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003569-M09-13-15-1.jpg
Application image note: Western Blot analysis of IL6 expression in transfected 293T cell line by IL6 monoclonal antibody (M09), clone 3F12.

Lane 1: IL6 transfected lysate(23.7 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL6 monoclonal antibody (M09), clone 3F12 now

Add to cart