IL4R monoclonal antibody (M02), clone 1D10 View larger

IL4R monoclonal antibody (M02), clone 1D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL4R monoclonal antibody (M02), clone 1D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about IL4R monoclonal antibody (M02), clone 1D10

Brand: Abnova
Reference: H00003566-M02
Product name: IL4R monoclonal antibody (M02), clone 1D10
Product description: Mouse monoclonal antibody raised against a partial recombinant IL4R.
Clone: 1D10
Isotype: IgG2a Kappa
Gene id: 3566
Gene name: IL4R
Gene alias: CD124|IL4RA
Gene description: interleukin 4 receptor
Genbank accession: NM_000418
Immunogen: IL4R (NP_000409, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNV
Protein accession: NP_000409
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003566-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged IL4R is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy IL4R monoclonal antibody (M02), clone 1D10 now

Add to cart