IL4R purified MaxPab mouse polyclonal antibody (B01P) View larger

IL4R purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL4R purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr,Flow Cyt

More info about IL4R purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003566-B01P
Product name: IL4R purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IL4R protein.
Gene id: 3566
Gene name: IL4R
Gene alias: CD124|IL4RA
Gene description: interleukin 4 receptor
Genbank accession: NM_001008699
Immunogen: IL4R (NP_001008699.1, 1 a.a. ~ 227 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGWLCSGLLFPVSCLVLLQVASSGNMKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSNIC
Protein accession: NP_001008699.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003566-B01P-13-15-1.jpg
Application image note: Western Blot analysis of IL4R expression in transfected 293T cell line (H00003566-T02) by IL4R MaxPab polyclonal antibody.

Lane 1: IL4R transfected lysate(24.97 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,Flow Cyt
Shipping condition: Dry Ice

Reviews

Buy IL4R purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart