IL4 polyclonal antibody (A01) View larger

IL4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IL4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00003565-A01
Product name: IL4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant IL4.
Gene id: 3565
Gene name: IL4
Gene alias: BCGF-1|BCGF1|BSF1|IL-4|MGC79402
Gene description: interleukin 4
Genbank accession: NM_000589
Immunogen: IL4 (NP_000580, 63 a.a. ~ 153 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Protein accession: NP_000580
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003565-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL4 polyclonal antibody (A01) now

Add to cart