Brand: | Abnova |
Reference: | H00003563-Q01 |
Product name: | IL3RA (Human) Recombinant Protein (Q01) |
Product description: | Human IL3RA partial ORF ( NP_002174, 19 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 3563 |
Gene name: | IL3RA |
Gene alias: | CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra |
Gene description: | interleukin 3 receptor, alpha (low affinity) |
Genbank accession: | NM_002183 |
Immunogen sequence/protein sequence: | TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN |
Protein accession: | NP_002174 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |