IL3RA polyclonal antibody (A01) View larger

IL3RA polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL3RA polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IL3RA polyclonal antibody (A01)

Brand: Abnova
Reference: H00003563-A01
Product name: IL3RA polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant IL3RA.
Gene id: 3563
Gene name: IL3RA
Gene alias: CD123|IL3R|IL3RAY|IL3RX|IL3RY|MGC34174|hIL-3Ra
Gene description: interleukin 3 receptor, alpha (low affinity)
Genbank accession: NM_002183
Immunogen: IL3RA (NP_002174, 19 a.a. ~ 109 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN
Protein accession: NP_002174
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003563-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.12 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL3RA polyclonal antibody (A01) now

Add to cart