IL2RG MaxPab mouse polyclonal antibody (B01) View larger

IL2RG MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL2RG MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about IL2RG MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003561-B01
Product name: IL2RG MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human IL2RG protein.
Gene id: 3561
Gene name: IL2RG
Gene alias: CD132|IMD4|SCIDX|SCIDX1
Gene description: interleukin 2 receptor, gamma (severe combined immunodeficiency)
Genbank accession: NM_000206.1
Immunogen: IL2RG (NP_000197.1, 1 a.a. ~ 369 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAPPCYTLKPET
Protein accession: NP_000197.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003561-B01-13-15-1.jpg
Application image note: Western Blot analysis of IL2RG expression in transfected 293T cell line (H00003561-T01) by IL2RG MaxPab polyclonal antibody.

Lane 1: IL2RG transfected lysate(40.59 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL2RG MaxPab mouse polyclonal antibody (B01) now

Add to cart