Brand: | Abnova |
Reference: | H00003557-P01 |
Product name: | IL1RN (Human) Recombinant Protein (P01) |
Product description: | Human IL1RN full-length ORF ( AAH09745, 1 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 3557 |
Gene name: | IL1RN |
Gene alias: | ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430 |
Gene description: | interleukin 1 receptor antagonist |
Genbank accession: | BC009745 |
Immunogen sequence/protein sequence: | MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Protein accession: | AAH09745 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: | |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Interleukin-1 alpha blockade prevents hyperkeratosis in an in vitro model of lamellar ichthyosis.O'Shaughnessy RF, Choudhary I, Harper JI. Hum Mol Genet. 2010 Apr 27. [Epub ahead of print] |