IL1RN monoclonal antibody (M01), clone M1-B9 View larger

IL1RN monoclonal antibody (M01), clone M1-B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1RN monoclonal antibody (M01), clone M1-B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about IL1RN monoclonal antibody (M01), clone M1-B9

Brand: Abnova
Reference: H00003557-M01
Product name: IL1RN monoclonal antibody (M01), clone M1-B9
Product description: Mouse monoclonal antibody raised against a full length recombinant IL1RN.
Clone: M1-B9
Isotype: IgG1 kappa
Gene id: 3557
Gene name: IL1RN
Gene alias: ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene description: interleukin 1 receptor antagonist
Genbank accession: BC009745
Immunogen: IL1RN (AAH09745, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MALETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Protein accession: AAH09745
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003557-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (43.23 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003557-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged IL1RN is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL1RN monoclonal antibody (M01), clone M1-B9 now

Add to cart