IL1RN MaxPab rabbit polyclonal antibody (D01) View larger

IL1RN MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1RN MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr,IP

More info about IL1RN MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00003557-D01
Product name: IL1RN MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human IL1RN protein.
Gene id: 3557
Gene name: IL1RN
Gene alias: ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430
Gene description: interleukin 1 receptor antagonist
Genbank accession: NM_173842.1
Immunogen: IL1RN (NP_776214.1, 1 a.a. ~ 177 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Protein accession: NP_776214.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003557-D01-13-15-1.jpg
Application image note: Western Blot analysis of IL1RN expression in transfected 293T cell line (H00003557-T02) by IL1RN MaxPab polyclonal antibody.

Lane 1: IL1RN transfected lysate(20.1 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy IL1RN MaxPab rabbit polyclonal antibody (D01) now

Add to cart