Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00003557-B01P |
Product name: | IL1RN purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human IL1RN protein. |
Gene id: | 3557 |
Gene name: | IL1RN |
Gene alias: | ICIL-1RA|IL-1ra3|IL1F3|IL1RA|IRAP|MGC10430 |
Gene description: | interleukin 1 receptor antagonist |
Genbank accession: | NM_173842 |
Immunogen: | IL1RN (NP_776214.1, 1 a.a. ~ 177 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE |
Protein accession: | NP_776214.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IL1RN expression in transfected 293T cell line (H00003557-T02) by IL1RN MaxPab polyclonal antibody. Lane 1: IL1RN transfected lysate(20.10 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |