Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL1B monoclonal antibody (M01), clone 2A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re,IP |
More info about IL1B monoclonal antibody (M01), clone 2A8
| Brand: | Abnova |
| Reference: | H00003553-M01 |
| Product name: | IL1B monoclonal antibody (M01), clone 2A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1B. |
| Clone: | 2A8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 3553 |
| Gene name: | IL1B |
| Gene alias: | IL-1|IL1-BETA|IL1F2 |
| Gene description: | interleukin 1, beta |
| Genbank accession: | BC008678 |
| Immunogen: | IL1B (AAH08678, 170 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Protein accession: | AAH08678 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged IL1B is approximately 10ng/ml as a capture antibody. |
| Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re,IP |
| Shipping condition: | Dry Ice |
| Publications: | Upregulation of MMP-13 via Runx2 in the stromal cell of Giant Cell Tumor.Mak IW, Cowan RW, Popovic S, Colterjohn N, Singh G, Ghert M. Bone. 2009 Aug;45(2):377-86. Epub 2009 May 5. |