Brand: | Abnova |
Reference: | H00003553-M01 |
Product name: | IL1B monoclonal antibody (M01), clone 2A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1B. |
Clone: | 2A8 |
Isotype: | IgG2b Kappa |
Gene id: | 3553 |
Gene name: | IL1B |
Gene alias: | IL-1|IL1-BETA|IL1F2 |
Gene description: | interleukin 1, beta |
Genbank accession: | BC008678 |
Immunogen: | IL1B (AAH08678, 170 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
Protein accession: | AAH08678 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged IL1B is approximately 10ng/ml as a capture antibody. |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |
Publications: | Upregulation of MMP-13 via Runx2 in the stromal cell of Giant Cell Tumor.Mak IW, Cowan RW, Popovic S, Colterjohn N, Singh G, Ghert M. Bone. 2009 Aug;45(2):377-86. Epub 2009 May 5. |