Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL1B purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr,PLA-Ce |
More info about IL1B purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00003553-D01P |
| Product name: | IL1B purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human IL1B protein. |
| Gene id: | 3553 |
| Gene name: | IL1B |
| Gene alias: | IL-1|IL1-BETA|IL1F2 |
| Gene description: | interleukin 1, beta |
| Genbank accession: | NM_000576 |
| Immunogen: | IL1B (AAH08678.1, 1 a.a. ~ 269 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS |
| Protein accession: | AAH08678.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | Western Blot analysis of IL1B expression in transfected 293T cell line (H00003553-T01) by IL1B MaxPab polyclonal antibody. Lane 1: IL1B transfected lysate(30.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Ginger Phenylpropanoids Inhibit IL-1{beta} and Prostanoid Secretion and Disrupt Arachidonate-Phospholipid Remodeling by Targeting Phospholipases A2.Nievergelt A, Marazzi J, Schoop R, Altmann KH, Gertsch J. J Immunol. 2011 Oct 15;187(8):4140-50. Epub 2011 Sep 9. |