IL1B purified MaxPab mouse polyclonal antibody (B01P) View larger

IL1B purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1B purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about IL1B purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00003553-B01P
Product name: IL1B purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human IL1B protein.
Gene id: 3553
Gene name: IL1B
Gene alias: IL-1|IL1-BETA|IL1F2
Gene description: interleukin 1, beta
Genbank accession: NM_000576
Immunogen: IL1B (AAH08678.1, 1 a.a. ~ 269 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
Protein accession: AAH08678.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003553-B01P-13-15-1.jpg
Application image note: Western Blot analysis of IL1B expression in transfected 293T cell line (H00003553-T01) by IL1B MaxPab polyclonal antibody.

Lane 1: IL1B transfected lysate(29.59 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IL1B purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart