Brand: | Abnova |
Reference: | H00003552-M04 |
Product name: | IL1A monoclonal antibody (M04), clone 4F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL1A. |
Clone: | 4F9 |
Isotype: | IgG1 Kappa |
Gene id: | 3552 |
Gene name: | IL1A |
Gene alias: | IL-1A|IL1|IL1-ALPHA|IL1F1 |
Gene description: | interleukin 1, alpha |
Genbank accession: | BC013142 |
Immunogen: | IL1A (AAH13142, 172 a.a. ~ 271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Protein accession: | AAH13142 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003552-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003552-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003552-M04-9-20-1.jpg](http://www.abnova.com/application_image/H00003552-M04-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged IL1A is 0.3 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |