IKBKB monoclonal antibody (M08), clone 3C12 View larger

IKBKB monoclonal antibody (M08), clone 3C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IKBKB monoclonal antibody (M08), clone 3C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about IKBKB monoclonal antibody (M08), clone 3C12

Brand: Abnova
Reference: H00003551-M08
Product name: IKBKB monoclonal antibody (M08), clone 3C12
Product description: Mouse monoclonal antibody raised against a partial recombinant IKBKB.
Clone: 3C12
Isotype: IgG2b Kappa
Gene id: 3551
Gene name: IKBKB
Gene alias: FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB
Gene description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Genbank accession: BC006231
Immunogen: IKBKB (AAH06231, 3 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
Protein accession: AAH06231
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003551-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.72 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003551-M08-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged IKBKB is approximately 0.3ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IKBKB monoclonal antibody (M08), clone 3C12 now

Add to cart