Brand: | Abnova |
Reference: | H00003551-M01 |
Product name: | IKBKB monoclonal antibody (M01), clone 2F4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IKBKB. |
Clone: | 2F4 |
Isotype: | IgG2b Kappa |
Gene id: | 3551 |
Gene name: | IKBKB |
Gene alias: | FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB |
Gene description: | inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta |
Genbank accession: | BC006231 |
Immunogen: | IKBKB (AAH06231, 3 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG |
Protein accession: | AAH06231 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003551-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003551-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.72 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003551-M01-9-22-1.jpg](http://www.abnova.com/application_image/H00003551-M01-9-22-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged IKBKB is approximately 0.03ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |