IKBKB MaxPab mouse polyclonal antibody (B01) View larger

IKBKB MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IKBKB MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about IKBKB MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00003551-B01
Product name: IKBKB MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human IKBKB protein.
Gene id: 3551
Gene name: IKBKB
Gene alias: FLJ40509|IKK-beta|IKK2|IKKB|MGC131801|NFKBIKB
Gene description: inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
Genbank accession: BC006231.2
Immunogen: IKBKB (AAH06231.1, 1 a.a. ~ 256 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQCVRMWPGTVAHSCNPSTLGGRGRWIS
Protein accession: AAH06231.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003551-B01-13-15-1.jpg
Application image note: Western Blot analysis of IKBKB expression in transfected 293T cell line (H00003551-T01) by IKBKB MaxPab polyclonal antibody.

Lane 1: IKBKB transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IKBKB MaxPab mouse polyclonal antibody (B01) now

Add to cart