Brand: | Abnova |
Reference: | H00003549-M05 |
Product name: | IHH monoclonal antibody (M05), clone 2F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IHH. |
Clone: | 2F3 |
Isotype: | IgG2a Kappa |
Gene id: | 3549 |
Gene name: | IHH |
Gene alias: | BDA1|HHG2 |
Gene description: | Indian hedgehog homolog (Drosophila) |
Genbank accession: | BC034757 |
Immunogen: | IHH (AAH34757, 119 a.a. ~ 217 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ESGARVALSAVRPGDRVLAMGEDGSPTFSDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQPGQYVLVAGVPG |
Protein accession: | AAH34757 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |