RBPJ monoclonal antibody (M01A), clone 4E12 View larger

RBPJ monoclonal antibody (M01A), clone 4E12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBPJ monoclonal antibody (M01A), clone 4E12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about RBPJ monoclonal antibody (M01A), clone 4E12

Brand: Abnova
Reference: H00003516-M01A
Product name: RBPJ monoclonal antibody (M01A), clone 4E12
Product description: Mouse monoclonal antibody raised against a partial recombinant RBPJ.
Clone: 4E12
Isotype: IgG2b Kappa
Gene id: 3516
Gene name: RBPJ
Gene alias: CBF1|IGKJRB|IGKJRB1|KBF2|MGC61669|RBP-J|RBPJK|RBPSUH|SUH|csl
Gene description: recombination signal binding protein for immunoglobulin kappa J region
Genbank accession: NM_203284
Immunogen: RBPJ (NP_976029, 3 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYC
Protein accession: NP_976029
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00003516-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.51 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00003516-M01A-1-6-1.jpg
Application image note: RBPJ monoclonal antibody (M01A), clone 4E12 Western Blot analysis of RBPJ expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RBPJ monoclonal antibody (M01A), clone 4E12 now

Add to cart