Brand: | Abnova |
Reference: | H00003516-M01 |
Product name: | RBPJ monoclonal antibody (M01), clone 4E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RBPJ. |
Clone: | 4E12 |
Isotype: | IgG2b Kappa |
Gene id: | 3516 |
Gene name: | RBPJ |
Gene alias: | CBF1|IGKJRB|IGKJRB1|KBF2|MGC61669|RBP-J|RBPJK|RBPSUH|SUH|csl |
Gene description: | recombination signal binding protein for immunoglobulin kappa J region |
Genbank accession: | NM_203284 |
Immunogen: | RBPJ (NP_976029, 3 a.a. ~ 109 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYC |
Protein accession: | NP_976029 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003516-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003516-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.51 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003516-M01-1-6-1.jpg](http://www.abnova.com/application_image/H00003516-M01-1-6-1.jpg) |
Application image note: | RBPJ monoclonal antibody (M01), clone 4E12 Western Blot analysis of RBPJ expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |