IGHA2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00003494-D01P
Product name: IGHA2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human IGHA2 protein.
Gene id: 3494
Gene name: IGHA2
Gene alias: -
Gene description: immunoglobulin heavy constant alpha 2 (A2m marker)
Genbank accession: BC073765.1
Immunogen: IGHA2 (AAH73765.1, 1 a.a. ~ 477 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKHLWFFLLLVAAPRWVLSQVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQTAGKGLEWIGYISHSGSTTYNPSLKSRVTLSLDTSKNQFSLRLNSVTAADTAVYYCAHGSSWDFAFDYWGQGTLVTVSSASPTSPKVFPLSLDSTPQDGNVVVACLVQGFFPQEPLSVTWSESGQNVTARNFPPSQDASGDLYTTSSQLTLPATQCPDGKSVTCHVKHYTNPSQDVTVPCPVPPPPPCCHPRLSLHRPALEDLLLGSEANLTCTLTGLRDASGATFTWTPSSGKSAVQGPPERDLCGCYSVSSVLPGCAQPWNHGETFTCTAAHPELKTPLTANITKSGNTFRPEVHLLPPPSEELALNELVTLTCLARGFSPKDVLVRWLQGSQELPREKYLTWASRQEPSQGTTTFAVTSILRVAAEDWKKGDTFSCMVGHEALPLAFTQKTIDRLAGKPTHVNVSVVMAEVDGTCY
Protein accession: AAH73765.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00003494-D01P-13-15-1.jpg
Application image note: Western Blot analysis of IGHA2 expression in transfected 293T cell line (H00003494-T02) by IGHA2 MaxPab polyclonal antibody.

Lane 1: IGHA2 transfected lysate(51.60 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy IGHA2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart