Brand: | Abnova |
Reference: | H00003489-M02 |
Product name: | IGFBP6 monoclonal antibody (M02), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant IGFBP6. |
Clone: | 1A8 |
Isotype: | IgG2a |
Gene id: | 3489 |
Gene name: | IGFBP6 |
Gene alias: | IBP6 |
Gene description: | insulin-like growth factor binding protein 6 |
Genbank accession: | BC003507.1 |
Immunogen: | IGFBP6 (AAH03507.1, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTPHRLLPPLLLLLALLLAASPGGALARCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG |
Protein accession: | AAH03507.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003489-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003489-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (52.14 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |