Brand: | Abnova |
Reference: | H00003486-M02 |
Product name: | IGFBP3 monoclonal antibody (M02), clone 2G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IGFBP3. |
Clone: | 2G6 |
Isotype: | IgG2a Kappa |
Gene id: | 3486 |
Gene name: | IGFBP3 |
Gene alias: | BP-53|IBP3 |
Gene description: | insulin-like growth factor binding protein 3 |
Genbank accession: | NM_000598.1 |
Immunogen: | IGFBP3 (NP_000589.1, 182 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK |
Protein accession: | NP_000589.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00003486-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00003486-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00003486-M02-9-22-1.jpg](http://www.abnova.com/application_image/H00003486-M02-9-22-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged IGFBP3 is 0.03 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |